
NBP1-56715 ARL13B antibody

See related secondary antibodies

Search for all "ARL13B"

Quick Overview

Rabbit anti Human ARL13B

Product Description for ARL13B

Rabbit anti Human ARL13B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ARL13B

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ARL13B(ADP-ribosylation factor-like 13B) The peptide sequence was selected from the middle region of ARL13B. Peptide sequence VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK.
Background ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 200894

Accessory Products

  • LinkedIn