H00339231-B01P ARL16 antibody

See related secondary antibodies

Search for all "ARL16"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ARL16

H00339231-B01P

Product Description for ARL16

Mouse anti Human ARL16.
Product is tested for Western blot / Immunoblot.

Properties for ARL16

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q0P5N6
Immunogen:
ARL16 (ADR82863.1, 1 a.a. ~ 197 a.a) full-length human protein.
AA Sequence:
MRVAGGRALSRGAELRVPGGAKHGMCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLTDIVAQR KITIRELGGCMGPIWSSYYGNCRSLLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEM KSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND
GeneID:
339231
Add. information Mouse polyclonal antibody raised against a full-length human ARL16 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for ARL16 (1 products)

Catalog No. Species Pres. Purity   Source  

ARL16 overexpression lysate

ARL16 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn