NBP1-70411 ARL17 antibody

See related secondary antibodies

Search for all "ARL17"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ARL17

Product Description for ARL17

Rabbit anti Human ARL17.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ARL17

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ARL17(ADP-ribosylation factor-like 17) The peptide sequence was selected from the middle region of ARL17. Peptide sequence KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD.
Background ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6415220

Accessory Products

  • LinkedIn