NBP1-93761 ASB15 antibody

See related secondary antibodies

Search for all "ASB15"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ASB15

Product Description for ASB15

Rabbit anti Human ASB15.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for ASB15

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WXK1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YEIVRLLLSHGANVNCYFMHVNDTRFPSVIQYALNDEVMLRLLLNNGYQVEMCFDCMHGDIFGNSFVWSEIQEEVLPGWTSCVIKDNPFCEFITVPWMKHLVGRVTRVLIDYMDYVPLCAKLKSALEVQRE
GeneID:
142685
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 142685

Accessory Products

Proteins and/or Positive Controls

Positive controls for ASB15 (1 products)

Catalog No. Species Pres. Purity   Source  

ASB15 overexpression lysate

ASB15 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn