NBP1-54385 Asialoglycoprotein Receptor 1 antibody

See related secondary antibodies

Search for all "Asialoglycoprotein Receptor 1"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human Asialoglycoprotein Receptor 1


Product Description for Asialoglycoprotein Receptor 1

Rabbit anti Canine, Human Asialoglycoprotein Receptor 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Asialoglycoprotein Receptor 1

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ASGR1 (asialoglycoprotein receptor 1) The peptide sequence was selected from the N terminal of ASGR1 . Peptide sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS.
Background ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 432

Accessory Products

  • LinkedIn