
NBP1-59195 ASTN2 antibody

See related secondary antibodies

Search for all "ASTN2"

Quick Overview

Rabbit anti Human, Mouse ASTN2

Product Description for ASTN2

Rabbit anti Human, Mouse ASTN2.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ASTN2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ASTN2(astrotactin 2) The peptide sequence was selected from the N terminal of ASTN2. Peptide sequence PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS.
Background ASTN2 may play an important role in neuronal functioning.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23245

Accessory Products

  • LinkedIn