
NBP1-59512 ATG9A antibody

See related secondary antibodies

Search for all "ATG9A"

Quick Overview

Rabbit anti Human ATG9A

Product Description for ATG9A

Rabbit anti Human ATG9A.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ATG9A

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ATG9A(ATG9 autophagy related 9 homolog A (S. cerevisiae)) The peptide sequence was selected from the middle region of ATG9A. Peptide sequence VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV.
Background ATG9A belongs to the ATG9 family. It plays a role in autophagy.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 79065

Accessory Products

  • LinkedIn