TA338063 Atlastin-3 antibody

Rabbit Polyclonal Anti-ATL3 Antibody

See related secondary antibodies

Search for all "Atlastin-3"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat Atlastin-3

Product Description for Atlastin-3

Rabbit anti Bovine, Human, Mouse, Rat Atlastin-3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Atlastin-3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ALT3
Presentation Aff - Purified
Reactivity Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6DD88
Immunogen:
Synthetic peptide directed towards the middle region of Human ATL3
AA Sequence:
ESGHSNWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAV
GeneID:
25923
Application Western blotting (0.2 - 1 µg/ml)
Background ATL3 is a GTPase tethering membranes through formation of trans-homooligomers and mediating homotypic fusion of endoplasmic reticulum membranes. It functions in endoplasmic reticulum tubular network biogenesis.
General Readings
  1. Rismanchi N, Soderblom C, Stadler J, Zhu PP, Blackstone C. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis. Hum Mol Genet. 2008 Jun 1;17(11):1591-604. doi: 10.1093/hmg/ddn046. Epub 2008 Feb 12. PubMed PMID: 18270207. (Free PMC Article available, 11 images available)
  2. Hu J, Shibata Y, Zhu PP, Voss C, Rismanchi N, Prinz WA, et al. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell. 2009 Aug 7;138(3):549-61. doi: 10.1016/j.cell.2009.05.025. PubMed PMID: 19665976. (Free PMC Article available, 7 images available)
Storage Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from dispatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Lyophilized from PBS with 2% sucrose
Aff - Purified
Reconstitution:
Add 50 μl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Horse, Pig, Rabbit, Bovine
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for Atlastin-3 (3 products)

Catalog No. Species Pres. Purity   Source  

Atlastin-3

Atlastin-3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Atlastin-3

Atlastin-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Atlastin-3

Atlastin-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Atlastin-3 (1 products)

Catalog No. Species Pres. Purity   Source  

ATL3 overexpression lysate

ATL3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn