TA341979 Atlastin-3 antibody

Rabbit Polyclonal Anti-DKFZP564J0863 Antibody

See related secondary antibodies

Search for all "Atlastin-3"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Atlastin-3

Product Description for Atlastin-3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Atlastin-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Atlastin-3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ALT3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6DD88
Immunogen:
The immunogen for anti-DKFZP564J0863 antibody: synthetic peptide directed towards the middle region of human DKFZP564J0863. Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA.
GeneID:
25923
Application WB
Background This gene encodes a member of a family of dymin-like, integral membrane GTPases.The encoded protein is required forThe proper formation ofThe network of interconnected tubules ofThe endoplasmic reticulum. Mutations inThis gene may be associated with hereditary sensory neuropathy type IF. Altertively spliced transcript variants that encode distinct isoforms have been described. [provided by RefSeq, Feb 2014].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Atlastin-3 (3 products)

Catalog No. Species Pres. Purity   Source  

Atlastin-3

Atlastin-3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Atlastin-3

Atlastin-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Atlastin-3

Atlastin-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Atlastin-3 (1 products)

Catalog No. Species Pres. Purity   Source  

ATL3 overexpression lysate

ATL3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn