NBP1-69111 ATP10D antibody

See related secondary antibodies

Search for all "ATP10D"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat ATP10D

NBP1-69111

Product Description for ATP10D

Rabbit anti Rat ATP10D.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ATP10D

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q46YB3
Immunogen:
Synthetic peptides corresponding to Atp10d (ATPase, class V, type 10D) The peptide sequence was selected from the middle region of Atp10d. Peptide sequence YAKRGLRTLCVAKKVMSDTEYAEWLRNHFLAETSIDNREELLVESAMRLE.
GeneID:
3609320
Background The function of Atp10d remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 3609320

Accessory Products

  • LinkedIn