discontinued

AP43551PU-N ATP5F1 antibody

See related secondary antibodies

Search for all "ATP5F1"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ATP5F1

AP43551PU-N

More Views

  • AP43551PU-N

Product Description for ATP5F1

Rabbit anti Bovine, Canine, Human, Mouse, Rat ATP5F1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ATP5F1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ATP synthase F(0) complex subunit B1, ATP synthase proton-transporting mitochondrial F(0) complex subunit B1, ATP synthase subunit b, mitochondrial ATP synthase subunit b
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P24539
Immunogen:
Synthetic peptide directed towards the middle region of human ATP5F1
AA Sequence:
VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST
GeneID:
515
Application Western blotting (0.2 - 1 µg/ml)
Background ATP5F1 is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.
Product Citations
Originator or purchased from resellers:
  1. Perciavalle RM, Stewart DP, Koss B, Lynch J, Milasta S, Bathina M, et al. Anti-apoptotic MCL-1 localizes to the mitochondrial matrix and couples mitochondrial fusion to respiration. Nat Cell Biol. 2012 Apr 29;14(6):575-83. doi: 10.1038/ncb2488. PubMed PMID: 22544066. (Free PMC Article available, 6 images available)
General Readings
  1. Ewing RM, Chu P, Elisma F, Li H, Taylor P, Climie S, et al. Large-scale mapping of human protein-protein interactions by mass spectrometry. Mol Syst Biol. 2007;3:89. Epub 2007 Mar 13. PubMed PMID: 17353931. (Free PMC Article available, 9 images available)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Pig, Dog
Species reactivity (tested):
Human
Gene ID 515

Accessory Products

Proteins and/or Positive Controls

Proteins for ATP5F1 (7 products)

Catalog No. Species Pres. Purity   Source  

ATP5F1 (full length, N-term HIS tag)

ATP5F1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ATP5F1 (83-256, His-tag)

ATP5F1 Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ATP5F1 (83-256, His-tag)

ATP5F1 Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ATP5F1

ATP5F1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ATP5F1

ATP5F1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ATP5F1

ATP5F1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP5F1

ATP5F1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ATP5F1 (2 products)

Catalog No. Species Pres. Purity   Source  

ATP5F1 293T Cell Transient Overexpression Lysate(Denatured)

ATP5F1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ATP5F1 Lysate

Western Blot: ATP5F1 Lysate [NBL1-07822] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ATP5F1 Protein
  Novus Biologicals Inc.
  • LinkedIn