discontinued

H00000515-B02 ATP5F1 antibody

See related secondary antibodies

Search for all "ATP5F1"

Quick Overview

Mouse anti Human ATP5F1

Product Description for ATP5F1

Mouse anti Human ATP5F1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ATP5F1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms ATP synthase F(0) complex subunit B1, ATP synthase proton-transporting mitochondrial F(0) complex subunit B1, ATP synthase subunit b, mitochondrial ATP synthase subunit b
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P24539
Immunogen:
ATP5F1 (NP_001679.2, 1 a.a. ~ 256 a.a) full-length human protein.
AA Sequence:
MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGP YVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDT EKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIS TQQEKETIAKCIADLKLLAKKAQAQPVM
GeneID:
515
Remarks:
Gene Accession: NM_001688.4
Add. information Mouse polyclonal antibody raised against a full-length human ATP5F1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 515

Accessory Products

Proteins and/or Positive Controls

Proteins for ATP5F1 (7 products)

Catalog No. Species Pres. Purity   Source  

ATP5F1 (full length, N-term HIS tag)

ATP5F1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ATP5F1 (83-256, His-tag)

ATP5F1 Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ATP5F1 (83-256, His-tag)

ATP5F1 Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ATP5F1

ATP5F1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ATP5F1

ATP5F1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ATP5F1

ATP5F1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP5F1

ATP5F1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ATP5F1 (2 products)

Catalog No. Species Pres. Purity   Source  

ATP5F1 293T Cell Transient Overexpression Lysate(Denatured)

ATP5F1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ATP5F1 Lysate

Western Blot: ATP5F1 Lysate [NBL1-07822] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ATP5F1 Protein
  Novus Biologicals Inc.
  • LinkedIn