discontinued

AP43239PU-N ATP6V0A2 antibody

See related secondary antibodies

Search for all "ATP6V0A2"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish ATP6V0A2

AP43239PU-N

More Views

  • AP43239PU-N
  • AP43239PU-N
  • AP43239PU-N
  • AP43239PU-N
  • AP43239PU-N

Product Description for ATP6V0A2

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish ATP6V0A2.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for ATP6V0A2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Lysosomal H(+)-transporting ATPase V0 subunit a2, TJ6, V-ATPase 116 kDa isoform a2, V-type proton ATPase 116 kDa subunit a isoform 2, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rt, Ze
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y487
Immunogen:
Synthetic peptide directed towards the N-terminal of human ATP6V0A2.
AA Sequence:
INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN
GeneID:
23545
Application Western blotting (0.2 - 1 µg/ml)
Immunocytochemisty / Immunofluorescence staining (2-8 µg/ml)
Immunohistochemistry on paraffin embedded sections (2-8 µg/ml)
Background The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain.The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain
Concentration 0.7 mg/ml
General Readings
  1. "Impaired glycosylation and cutis laxa caused by mutations in the vesicular H+-ATPase subunit ATP6V0A2." Kornak U., Reynders E., Dimopoulou A., van Reeuwijk J., Fischer B., Rajab A., Budde B., Nuernberg P., Foulquier F., Dobyns W.B., Quelhas D., Vilarinho L., Leao-Teles E., Greally M., Seemanova E., Simandlova M., Salih M., Nanda A. expand/collapse author list Mundlos S. Nat. Genet. 40:32-34(2008)
  2. Hurtado-Lorenzo A, Skinner M, El Annan J, Futai M, Sun-Wada GH, Bourgoin S, et al. V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. Nat Cell Biol. 2006 Feb;8(2):124-36. Epub 2006 Jan 15. PubMed PMID: 16415858.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Horse, Pig
Species reactivity (tested):
Human
Gene ID 23545

Accessory Products

Proteins and/or Positive Controls

Proteins for ATP6V0A2 (4 products)

Catalog No. Species Pres. Purity   Source  

ATP6V0A2

ATP6V0A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP6V0A2

ATP6V0A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP6V0A2

ATP6V0A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP6V0A2

ATP6V0A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn