discontinued

NBP1-55213 ATP6V1B1 antibody

See related secondary antibodies

Search for all "ATP6V1B1"

50 µg / €390.00

Quick Overview

Rabbit anti Human ATP6V1B1

NBP1-55213

Product Description for ATP6V1B1

Rabbit anti Human ATP6V1B1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ATP6V1B1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ATP6B1, MGC32642, RTA1B, VATB, VMA2, VPP3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P11593
Immunogen:
Synthetic peptides corresponding to ATP6V1B1(ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1) The peptide sequence was selected from the middle region of ATP6V1B1. Peptide sequence LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSE
GeneID:
3879313
Background This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 3879313

Accessory Products

  • LinkedIn