discontinued

H00245973-M01 ATP6V1C2 antibody

See related secondary antibodies

Search for all "ATP6V1C2"

Quick Overview

Mouse anti Human ATP6V1C2 3D5

H00245973-M01

More Views

  • H00245973-M01

Product Description for ATP6V1C2

Mouse anti Human ATP6V1C2 3D5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for ATP6V1C2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms V-ATPase subunit C 2, V-type proton ATPase subunit C 2, Vacuolar proton pump subunit C 2
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3D5
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEY4
Immunogen:
ATP6V1C2 (NP_653184, 188 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD*
GeneID:
245973
Remarks:
Gene Accession: NM_144583
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant ATP6V1C2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 245973

Accessory Products

Proteins and/or Positive Controls

Proteins for ATP6V1C2 (5 products)

Catalog No. Species Pres. Purity   Source  

ATP6V1C2 (full length, N-term HIS tag, transcript variant 2)

ATP6V1C2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ATP6V1C2

ATP6V1C2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ATP6V1C2

ATP6V1C2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ATP6V1C2

ATP6V1C2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP6V1C2

ATP6V1C2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ATP6V1C2 (4 products)

Catalog No. Species Pres. Purity   Source  

ATP6V1C2 293T Cell Transient Overexpression Lysate(Denatured)

ATP6V1C2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ATP6V1C2 Lysate

Western Blot: ATP6V1C2 Lysate [NBL1-07841] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ATP6V1C2 Protein
  Novus Biologicals Inc.

ATP6V1C2 overexpression lysate

ATP6V1C2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ATP6V1C2 overexpression lysate

ATP6V1C2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn