
NBP1-56969 ATPAF1 antibody

See related secondary antibodies

Search for all "ATPAF1"

Quick Overview

Rabbit anti Human ATPAF1

Product Description for ATPAF1

Rabbit anti Human ATPAF1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ATPAF1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ATPAF1 (ATP synthase mitochondrial F1 complex assembly factor 1) The peptide sequence was selected from the N terminal of ATPAF1. Peptide sequence GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI.
Background This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 64756

Accessory Products

  • LinkedIn