discontinued

NBP1-56311 ATXN7L1 antibody

See related secondary antibodies

Search for all "ATXN7L1"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse ATXN7L1

Product Description for ATXN7L1

Rabbit anti Human, Mouse ATXN7L1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ATXN7L1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ATXN7L4, FLJ40255, KIAA1218, MGC10760, MGC33190
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4D0Q2
Immunogen:
Synthetic peptides corresponding to ATXN7L1(ataxin 7-like 1) The peptide sequence was selected from the middle region of ATXN7L1. Peptide sequence KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED.
GeneID:
222255
Background The exact function of ATXN7L1 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 222255

Accessory Products

  • LinkedIn