NBP1-56311 ATXN7L1 antibody

See related secondary antibodies

Search for all "ATXN7L1"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse ATXN7L1

Product Description for ATXN7L1

Rabbit anti Human, Mouse ATXN7L1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ATXN7L1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ATXN7L4, FLJ40255, KIAA1218, MGC10760, MGC33190
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ATXN7L1(ataxin 7-like 1) The peptide sequence was selected from the middle region of ATXN7L1. Peptide sequence KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED.
Background The exact function of ATXN7L1 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 222255

Accessory Products

  • LinkedIn