TA346843 B3GNT4 antibody

Rabbit Polyclonal Anti-B3GNT4 Antibody

See related secondary antibodies

Search for all "B3GNT4"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat B3GNT4

Product Description for B3GNT4

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat B3GNT4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for B3GNT4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 3-N-acetylglucosaminyltransferase 4, 3-N-acetylglucosaminyltransferase-4, BGnT-4, Beta-1, Beta3Gn-T4, UDP-GlcNAc:betaGal beta-1, UNQ1898/PRO4344
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-B3GNT4 antibody: synthetic peptide directed towards the N terminal of human B3GNT4. Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR.
Application WB
Background This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein. [provided by RefSeq, Jul 2008].
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for B3GNT4 (2 products)

Catalog No. Species Pres. Purity   Source  


B3GNT4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


B3GNT4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn