TA341892 BACE1 antibody

Rabbit Polyclonal Anti-BACE1 Antibody

See related secondary antibodies

Search for all "BACE1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish BACE1

TA341892

More Views

  • TA341892
  • TA341892
  • TA341892
  • TA341892

Product Description for BACE1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish BACE1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for BACE1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ASP2, Aspartyl protease 2, BACE, BACE-1, Beta-secretase 1, Beta-site APP cleaving enzyme 1, Beta-site amyloid precursor protein cleaving enzyme 1, KIAA1149, Memapsin-2, Membrane-associated aspartic protease 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P56817
Immunogen:
The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY.
GeneID:
23621
Application WB
IHC
Background Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which isThe protein encoded byThis gene.The encoded protein, a member ofThe peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly inThe Golgi. Multiple transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, May 2011].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BACE1 (14 products)

Catalog No. Species Pres. Purity   Source  

BACE1 (transcript variant a)

BACE1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BACE1

BACE1 Human Purified > 95% as determined by SDS-PAGE E. coli
  OriGene Technologies GmbH

BACE1

BACE1 Human Purified > 95% as determined by SDS-PAGE E. coli
  OriGene Technologies GmbH

BACE1

BACE1 Human Purified > 95% as determined by SDS-PAGE E. coli
  OriGene Technologies GmbH

BACE1

BACE1 Human in vitro transl.
  Abnova Taiwan Corp.

BACE1

BACE1 Human in vitro transl.
  Abnova Taiwan Corp.

BACE1

BACE1 Human in vitro transl.
  Abnova Taiwan Corp.

BACE1

BACE1 Human
  Abnova Taiwan Corp.

BACE1

BACE1 Human
  Abnova Taiwan Corp.

BACE1

BACE1 Human
  Abnova Taiwan Corp.

BACE1

BACE1 Human
  Abnova Taiwan Corp.

BACE1 (EC domain 1-460)

BACE1 Human Purified
  Alpha Diagnostic Intl. Inc.

BACE1

BACE1 Human Purified > 95 % NSO cells
50 µg / €410.00
  Neuromics Antibodies

BACE1

BACE1 Mouse Purified > 90 % NSO cells
50 µg / €410.00
  Neuromics Antibodies
  • LinkedIn