discontinued

H00010458-B01 BAIAP2 antibody

See related secondary antibodies

Search for all "BAIAP2"

Quick Overview

Mouse anti Human BAIAP2

Product Description for BAIAP2

Mouse anti Human BAIAP2.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for BAIAP2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BAI-associated protein 2, BAI1-associated protein 2, BAP2, Brain-specific angiogenesis inhibitor 1-associated protein 2, FLAF3, Fas ligand-associated factor 3, IRS-58, IRSp53, IRSp53/58, Insulin receptor substrate p53, Insulin receptor substrate p53/p58, Insulin receptor substrate protein of 53 kDa
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UQB8
Immunogen:
BAIAP2 (NP_059345, 1 a.a. ~ 552 a.a) full-length human protein.
AA Sequence:
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVL FQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSK NPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQ ACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTG PDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVK AIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTG NLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLS AQGPEGREHGDGSARTLAGR
GeneID:
10458
Remarks:
Gene Accession: NM_017451
Add. information Mouse polyclonal antibody raised against a full-length human BAIAP2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10458

Accessory Products

Proteins and/or Positive Controls

Proteins for BAIAP2 (9 products)

Catalog No. Species Pres. Purity   Source  

BAIAP2 (transcript variant 1)

BAIAP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

BAIAP2 (transcript variant 3)

BAIAP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BAIAP2 (transcript variant 2)

BAIAP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BAIAP2 (full length, C-term DDK tag, transcript variant 1)

BAIAP2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

BAIAP2 (1-522, His-tag)

BAIAP2 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

BAIAP2 (1-522, His-tag)

BAIAP2 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

BAIAP2

BAIAP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BAIAP2

BAIAP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BAIAP2

BAIAP2 Human
  Abnova Taiwan Corp.

Positive controls for BAIAP2 (8 products)

Catalog No. Species Pres. Purity   Source  

BAIAP2 293T Cell Transient Overexpression Lysate(Denatured)

BAIAP2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BAIAP2 Lysate (Non-Denatured)

BAIAP2 Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-BAIAP2 antibody (H00010458-M01) by Western Blots.
  Abnova Taiwan Corp.

BAIAP2 Lysate

Western Blot: BAIAP2 Lysate [NBL1-07906] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BAIAP2 Protein
  Novus Biologicals Inc.

BAIAP2 Lysate

Western Blot: BAIAP2 Lysate [NBL1-07907] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for BAIAP2. Protein
  Novus Biologicals Inc.

BAIAP2 overexpression lysate

BAIAP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BAIAP2 overexpression lysate

BAIAP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BAIAP2 overexpression lysate

BAIAP2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

BAIAP2 overexpression lysate

BAIAP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn