NBP1-69711 BAP29 antibody

See related secondary antibodies

Search for all "BAP29"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human BAP29

Product Description for BAP29

Rabbit anti Human BAP29.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for BAP29

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to BCAP29(B-cell receptor-associated protein 29) The peptide sequence was selected from the middle region of BCAP29. Peptide sequence GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT.
Background BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 55973

Accessory Products

  • LinkedIn