discontinued

NBP1-69711 BAP29 antibody

See related secondary antibodies

Search for all "BAP29"

50 µg / €440.00

Quick Overview

Rabbit anti Human BAP29

Product Description for BAP29

Rabbit anti Human BAP29.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for BAP29

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NCU1
Immunogen:
Synthetic peptides corresponding to BCAP29(B-cell receptor-associated protein 29) The peptide sequence was selected from the middle region of BCAP29. Peptide sequence GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT.
GeneID:
55973
Background BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 55973

Accessory Products

  • LinkedIn