discontinued

H00056751-M01 BARHL1 antibody

See related secondary antibodies

Search for all "BARHL1"

Quick Overview

Mouse anti Human, Mouse, Rat BARHL1 2B11

H00056751-M01

More Views

  • H00056751-M01
  • H00056751-M01

Product Description for BARHL1

Mouse anti Human, Mouse, Rat BARHL1 2B11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for BARHL1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BARH1, BarH-like 1 homeobox protein, FKSG31
Presentation Purified
Reactivity Hu, Ms, Rt
Applications E, WB
Clonality Monoclonal
Clone 2B11
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZE3
Immunogen:
BARHL1 (NP_064448, 55 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
GRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLA AKAAEDFRDKLDKSGSNASSDSEY*
GeneID:
56751
Remarks:
Gene Accession: NM_020064
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant BARHL1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 56751

Accessory Products

Proteins and/or Positive Controls

Proteins for BARHL1 (5 products)

Catalog No. Species Pres. Purity   Source  

BARHL1

BARHL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BARHL1

BARHL1 Human Purified
  Abnova Taiwan Corp.

BARHL1

BARHL1 Human Purified
  Abnova Taiwan Corp.

BARHL1

BARHL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BARHL1

BARHL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BARHL1 (2 products)

Catalog No. Species Pres. Purity   Source  

BARHL1 293T Cell Transient Overexpression Lysate(Denatured)

BARHL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BARHL1 overexpression lysate

BARHL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn