discontinued

H00000585-B01P BBS4 antibody

See related secondary antibodies

Search for all "BBS4"

Quick Overview

Mouse anti Human BBS4

Product Description for BBS4

Mouse anti Human BBS4.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for BBS4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Bardet-Biedl syndrome 4 protein
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96RK4
Immunogen:
BBS4 (NP_149017.2, 1 a.a. ~ 519 a.a) full-length human protein.
AA Sequence:
MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALI FRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFN KAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNA LTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDW KILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAV LLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPA SFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK
GeneID:
585
Remarks:
Gene Accession: NM_033028.2
Add. information Mouse polyclonal antibody raised against a full-length human BBS4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 585

Accessory Products

Proteins and/or Positive Controls

Proteins for BBS4 (4 products)

Catalog No. Species Pres. Purity   Source  

BBS4

BBS4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BBS4

BBS4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BBS4

BBS4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BBS4

BBS4 Human
  Abnova Taiwan Corp.

Positive controls for BBS4 (2 products)

Catalog No. Species Pres. Purity   Source  

BBS4 Lysate(Denatured)

BBS4 Lysate(Denatured)
  Abnova Taiwan Corp.

BBS4 Lysate

Western Blot: BBS4 Lysate [NBL1-07929] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BBS4 Protein
  Novus Biologicals Inc.
  • LinkedIn