TA344647 BBS4 antibody

Rabbit Polyclonal Anti-BBS4 Antibody - N-terminal region

See related secondary antibodies

Search for all "BBS4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish BBS4


More Views

  • TA344647

Product Description for BBS4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish BBS4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BBS4

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Bardet-Biedl syndrome 4 protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-BBS4 antibody: synthetic peptide directed towards the N terminal of human BBS4. Synthetic peptide located within the following region: YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA.
Application WB
Background This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, rel malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse. The similar phenotypes exhibited by mutations in BBS gene family members are likely due to the protein's shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport. The protein encoded by this gene has sequence similarity to O-linked N-acetylglucosamine (O-Glcc) transferases in plants and archaebacteria and in human forms a multi-protein 'BBSome' complex with six other BBS proteins. Altertive splice variants have been described but their predicted protein products have not been experimentally verified.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for BBS4 (4 products)

Catalog No. Species Pres. Purity   Source  


BBS4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


BBS4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


BBS4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


BBS4 Human
  Abnova Taiwan Corp.

Positive controls for BBS4 (2 products)

Catalog No. Species Pres. Purity   Source  

BBS4 Lysate(Denatured)

BBS4 Lysate(Denatured)
  Abnova Taiwan Corp.

BBS4 Lysate

Western Blot: BBS4 Lysate [NBL1-07929] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BBS4 Protein
  Novus Biologicals Inc.
  • LinkedIn