discontinued

H00010134-M01A BCAP31 / BAP31 antibody

See related secondary antibodies

Search for all "BCAP31 / BAP31"

Quick Overview

Mouse anti Human BCAP31 / BAP31 3C5

H00010134-M01A

More Views

  • H00010134-M01A

Product Description for BCAP31 / BAP31

Mouse anti Human BCAP31 / BAP31 3C5.
Presentation: Ascites
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for BCAP31 / BAP31

Product Category Primary Antibodies
Target Category
Quantity 0.2 ml
Synonyms 6C6-AG tumor-associated antigen, B-cell receptor-associated protein 31, BCR-associated protein Bap31, DXS1357E, Protein CDM, p28 Bap31
Presentation Ascites
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3C5
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P51572
Immunogen:
BCAP31 (NP_005736, 137 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
AA Sequence:
KKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAM RKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE*
GeneID:
10134
Remarks:
Gene Accession: NM_005745
Add. information Mouse monoclonal antibody raised against a partial recombinant BCAP31.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re,WB-Ti
Storage In ascites fluid
Format
Label:
None
Purification:
Ascites
Buffer System:
In ascites fluid
Purity:
Ascites
State:
Ascites
Specificity
Species:
Human
Gene ID 10134

Accessory Products

Proteins and/or Positive Controls

Proteins for BCAP31 / BAP31 (7 products)

Catalog No. Species Pres. Purity   Source  

BCAP31 / BAP31 (transcript variant 2)

BCAP31 / BAP31 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BCAP31 / BAP31 (transcript variant 3)

BCAP31 / BAP31 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

BCAP31 / BAP31 (transcript variant 1)

BCAP31 / BAP31 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BCAP31 / BAP31

BCAP31 / BAP31 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

BCAP31 / BAP31

BCAP31 / BAP31 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

BCAP31 / BAP31

BCAP31 / BAP31 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BCAP31 / BAP31

BCAP31 / BAP31 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BCAP31 / BAP31 (5 products)

Catalog No. Species Pres. Purity   Source  

BCAP31 / BAP31 Lysate(Denatured)

BCAP31 / BAP31 Lysate(Denatured)
  Abnova Taiwan Corp.

BCAP31 Lysate

Western Blot: BCAP31 Lysate [NBL1-07934] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BCAP31 Protein
  Novus Biologicals Inc.

BCAP31 overexpression lysate

BCAP31 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BCAP31 overexpression lysate

BCAP31 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BCAP31 overexpression lysate

BCAP31 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn