discontinued

H00008412-A01 BCAR3 / SH2D3B antibody

See related secondary antibodies

Search for all "BCAR3 / SH2D3B"

Quick Overview

Mouse anti Human BCAR3 / SH2D3B

Product Description for BCAR3 / SH2D3B

Mouse anti Human BCAR3 / SH2D3B.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for BCAR3 / SH2D3B

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Breast cancer anti-estrogen resistance protein 3, NSP2, Novel SH2-containing protein 2, SH2 domain-containing protein 3B
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75815
Immunogen:
BCAR3 (AAH39895, 266 a.a. ~ 373 a.a) partial recombinant protein with GST tag.
AA Sequence:
YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESY LPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA
GeneID:
8412
Remarks:
Gene Accession: BC039895
Add. information Mouse polyclonal antibody raised against a partial recombinant BCAR3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 8412

Accessory Products

Proteins and/or Positive Controls

Proteins for BCAR3 / SH2D3B (3 products)

Catalog No. Species Pres. Purity   Source  

BCAR3 / SH2D3B

BCAR3 / SH2D3B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

BCAR3 / SH2D3B

BCAR3 / SH2D3B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BCAR3 / SH2D3B

BCAR3 / SH2D3B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BCAR3 / SH2D3B (3 products)

Catalog No. Species Pres. Purity   Source  

BCAR3 Lysate

Western Blot: BCAR3 Lysate [NBL1-07936] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BCAR3 Protein
  Novus Biologicals Inc.

BCAR3 overexpression lysate

BCAR3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BCAR3 / SH2D3B Lysate (Non-Denatured)

BCAR3 / SH2D3B Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-BCAR3 antibody (H00008412-M01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn