NBP1-69020 BCAT1 antibody

See related secondary antibodies

Search for all "BCAT1"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse BCAT1

NBP1-69020

Product Description for BCAT1

Rabbit anti Mouse BCAT1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for BCAT1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ECA39
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8CBC8
Immunogen:
Synthetic peptides corresponding to Bcat1 (branched chain aminotransferase 1, cytosolic) The peptide sequence was selected from the C terminal of Bcat1. Peptide sequence ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI.
GeneID:
12035
Background The function of Bcat1 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 12035

Accessory Products

  • LinkedIn