discontinued

H00010017-D01P Bcl-2-like 10 antibody

See related secondary antibodies

Search for all "Bcl-2-like 10"

Quick Overview

Rabbit anti Human Bcl-2-like 10

Product Description for Bcl-2-like 10

Rabbit anti Human Bcl-2-like 10.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Bcl-2-like 10

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Anti-apoptotic protein NrH, Apoptosis regulator Bcl-B, BCL2L10, BCLB, Bcl-B, Bcl2-L-10, NrH
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HD36
Immunogen:
BCL2L10 (NP_065129.1, 1 a.a. ~ 204 a.a) full-length human protein.
AA Sequence:
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFE LVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQ HRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
GeneID:
10017
Remarks:
Gene Accession: NM_020396
Add. information Rabbit polyclonal antibody raised against a full-length human BCL2L10 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10017

Accessory Products

Proteins and/or Positive Controls

Proteins for Bcl-2-like 10 (6 products)

Catalog No. Species Pres. Purity   Source  

Bcl-2-like 10 (1-172, His-tag)

Bcl-2-like 10 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

Bcl-2-like 10 (1-172, His-tag)

Bcl-2-like 10 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

Bcl-2-like 10

Bcl-2-like 10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Bcl-2-like 10

Bcl-2-like 10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Bcl-2-like 10

Bcl-2-like 10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-2-like 10

Bcl-2-like 10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Bcl-2-like 10 (1 products)

Catalog No. Species Pres. Purity   Source  

BCL2L10 293T Cell Transient Overexpression Lysate(Denatured)

BCL2L10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn