discontinued

H00010017-M03 Bcl-2-like 10 antibody

See related secondary antibodies

Search for all "Bcl-2-like 10"

Quick Overview

Mouse anti Human Bcl-2-like 10 1B11

Product Description for Bcl-2-like 10

Mouse anti Human Bcl-2-like 10 1B11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Bcl-2-like 10

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Anti-apoptotic protein NrH, Apoptosis regulator Bcl-B, BCL2L10, BCLB, Bcl-B, Bcl2-L-10, NrH
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1B11
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HD36
Immunogen:
BCL2L10 (NP_065129, 1 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFE LVALMADSVLSDSPGP*
GeneID:
10017
Remarks:
Gene Accession: NM_020396
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant BCL2L10.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10017

Accessory Products

Proteins and/or Positive Controls

Proteins for Bcl-2-like 10 (6 products)

Catalog No. Species Pres. Purity   Source  

Bcl-2-like 10 (1-172, His-tag)

Bcl-2-like 10 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

Bcl-2-like 10 (1-172, His-tag)

Bcl-2-like 10 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

Bcl-2-like 10

Bcl-2-like 10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Bcl-2-like 10

Bcl-2-like 10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Bcl-2-like 10

Bcl-2-like 10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-2-like 10

Bcl-2-like 10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Bcl-2-like 10 (1 products)

Catalog No. Species Pres. Purity   Source  

BCL2L10 293T Cell Transient Overexpression Lysate(Denatured)

BCL2L10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn