discontinued

H00079370-D01P Bcl-2-like 14 antibody

See related secondary antibodies

Search for all "Bcl-2-like 14"

Quick Overview

Rabbit anti Human Bcl-2-like 14

Product Description for Bcl-2-like 14

Rabbit anti Human Bcl-2-like 14.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Bcl-2-like 14

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Apoptosis facilitator Bcl-2-like protein 14, BCL2L14, BCLG, Bcl-G, Bcl2-L-14
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZR8
Immunogen:
BCL2L14 (NP_620048.1, 1 a.a. ~ 327 a.a) full-length human protein.
AA Sequence:
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRN SQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVIS IANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLK KDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKEN FSPWIQQHGGWEKILGISHEEVD
GeneID:
79370
Remarks:
Gene Accession: NM_138722
Add. information Rabbit polyclonal antibody raised against a full-length human BCL2L14 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 79370

Accessory Products

Proteins and/or Positive Controls

Proteins for Bcl-2-like 14 (4 products)

Catalog No. Species Pres. Purity   Source  

Bcl-2-like 14 (transcript variant 1)

Bcl-2-like 14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Bcl-2-like 14 (transcript variant 4)

Bcl-2-like 14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Bcl-2-like 14

Bcl-2-like 14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-2-like 14

Bcl-2-like 14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Bcl-2-like 14 (4 products)

Catalog No. Species Pres. Purity   Source  

BCL2L14 overexpression lysate

BCL2L14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BCL2L14 overexpression lysate

BCL2L14 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

Bcl-2-like 14 Lysate(Denatured)

Bcl-2-like 14 Lysate(Denatured)
  Abnova Taiwan Corp.

Bcl G Lysate

Western Blot: Bcl G Lysate [NBL1-07949] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for BCL2L14. Protein
  Novus Biologicals Inc.
  • LinkedIn