discontinued

H00079370-M01 Bcl-2-like 14 antibody

See related secondary antibodies

Search for all "Bcl-2-like 14"

Quick Overview

Mouse anti Human Bcl-2-like 14 1F2

H00079370-M01

More Views

  • H00079370-M01

Product Description for Bcl-2-like 14

Mouse anti Human Bcl-2-like 14 1F2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Bcl-2-like 14

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Apoptosis facilitator Bcl-2-like protein 14, BCL2L14, BCLG, Bcl-G, Bcl2-L-14
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1F2
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZR8
Immunogen:
BCL2L14 (AAH25778, 1 a.a. ~ 328 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRN SQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVIS IANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLK KDKALMGHFQDGLSYSVFKTITDQVLM
GeneID:
79370
Remarks:
Gene Accession: BC025778
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant BCL2L14.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 79370

Accessory Products

Proteins and/or Positive Controls

Proteins for Bcl-2-like 14 (4 products)

Catalog No. Species Pres. Purity   Source  

Bcl-2-like 14 (transcript variant 1)

Bcl-2-like 14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Bcl-2-like 14 (transcript variant 4)

Bcl-2-like 14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Bcl-2-like 14

Bcl-2-like 14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-2-like 14

Bcl-2-like 14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Bcl-2-like 14 (4 products)

Catalog No. Species Pres. Purity   Source  

BCL2L14 overexpression lysate

BCL2L14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BCL2L14 overexpression lysate

BCL2L14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Bcl-2-like 14 Lysate(Denatured)

Bcl-2-like 14 Lysate(Denatured)
  Abnova Taiwan Corp.

Bcl G Lysate

Western Blot: Bcl G Lysate [NBL1-07949] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for BCL2L14. Protein
  Novus Biologicals Inc.
  • LinkedIn