discontinued

H00000572-M02 Bcl-2-like 8 antibody

See related secondary antibodies

Search for all "Bcl-2-like 8"

Quick Overview

Mouse anti Human Bcl-2-like 8 3H8

H00000572-M02

More Views

  • H00000572-M02

Product Description for Bcl-2-like 8

Mouse anti Human Bcl-2-like 8 3H8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Bcl-2-like 8

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BAD, BBC6, BCL2L8, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter, Bcl2 antagonist of cell death, Bcl2-L-8
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3H8
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92934
Immunogen:
BAD (AAH01901, 69 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
IRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQS SSWTRVFQSWWDRNLGRGSSAPSQ
GeneID:
572
Remarks:
Gene Accession: BC001901
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant BAD.

Antibody Reactive Against Recombinant Protein.
Application ELISA,PLA-Ce,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 572

Accessory Products

Proteins and/or Positive Controls

Proteins for Bcl-2-like 8 (15 products)

Catalog No. Species Pres. Purity   Source  

Bcl-2-like 8 (transcript variant 1)

Bcl-2-like 8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Bcl-2-like 8 (full length, N-term HIS tag, transcript variant 2)

Bcl-2-like 8 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Bcl-2-like 8

Bcl-2-like 8 Human Purified E. coli
  Acris Antibodies GmbH

Bcl-2-like 8

Bcl-2-like 8 Human Purified E. coli
  Acris Antibodies GmbH

Bcl-2-like 8

Bcl-2-like 8 Human Purified E. coli
  Acris Antibodies GmbH

Bcl-2-like 8

Bcl-2-like 8 Human
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human
  Abnova Taiwan Corp.

Bcl-2-like 8

Bcl-2-like 8 Human
  Abnova Taiwan Corp.

Positive controls for Bcl-2-like 8 (1 products)

Catalog No. Species Pres. Purity   Source  

Bad Lysate

Western Blot: Bad Lysate [NBL1-07900] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for BAD. Protein
  Novus Biologicals Inc.
  • LinkedIn