discontinued

H00000613-B01 BCR antibody

See related secondary antibodies

Search for all "BCR"

Quick Overview

Mouse anti Human BCR

Product Description for BCR

Mouse anti Human BCR.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for BCR

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BCR1, Breakpoint cluster region protein, D22S11, NY-REN-26, Renal carcinoma antigen NY-REN-26
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P11274
Immunogen:
BCR (AAH66122.1, 1 a.a. ~ 1076 a.a) full-length human protein.
AA Sequence:
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRWG FRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVA ALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASR PPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSE QEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDS SSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYI DDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAAT TSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKC CQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNF LSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLT DLSFQMVDELEAVPNIPLVPDEELDALKIKISQIKSDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRV HSRNGKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGF LNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKIPK EDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRER SKVPYIVRQCVE
GeneID:
613
Remarks:
Gene Accession: BC066122.1
Add. information Mouse polyclonal antibody raised against a full-length human BCR protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 613

Accessory Products

Proteins and/or Positive Controls

Proteins for BCR (3 products)

Catalog No. Species Pres. Purity   Source  

BCR (transcript variant 2)

BCR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BCR

BCR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

BCR

BCR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for BCR (2 products)

Catalog No. Species Pres. Purity   Source  

BCR 293T Cell Transient Overexpression Lysate(Denatured)

BCR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BCR overexpression lysate

BCR overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn