discontinued

H00139105-B01P BEND2 antibody

See related secondary antibodies

Search for all "BEND2"

Quick Overview

Mouse anti Human BEND2

Product Description for BEND2

Mouse anti Human BEND2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for BEND2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BEN domain-containing protein 2, CXorf20
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NDZ0
Immunogen:
CXorf20 (NP_699177.1, 1 a.a. ~ 799 a.a) full-length human protein.
AA Sequence:
MSERTQEQDFVIITVDDSDDNNDCSIEMVEVSETADNSTNDIADDSTYVTADNPTDDTATQPNFPGGNDGHHRPLQ MSYGSGSVTQAGVQWHDHSSLQPQPLGLKQFFHLSLPSSWDDRRTPPCPVAHGDQIVSQINHPVHLRRYSYNSEEV DFPKRGRFYTPEVQSSISPPAERQETHAWASPAVTSLESAACHELQEADLSESLSYPRIVSSSSLQQYVAQGGSFP CFGMPWNFISGGAESTNAVISFANATTAVPMAVLSRRESSLANNPGVVNYSALPENENVGPGRALSSFCFHPNLEM PERPANSSKNSTETANYPTLMGNYNGQNTASLSVFIPPYFAEKIILTEMPGTTETNVENNSQTVYYPALSGNTSAP YPASSYLPITSNFESGPQMSYGTMSYSTEMKNNCDQDDASASACLTPDFALLPLNILVKVDTNTENSVNTMNRSTL LDSDSGQDSSSSSVCIPPKYGYLGDPKRNVRVLKIHLLAVQNMAKPKQAACYLVRILFSKEILISSSVDIHLKDSQ SLDPNKMAALREYLATTFPTCDLHEHGKDWQDCISGINSMIYCLCSEGKSTPKTVRKNKKRTNRVASASADRNDQR GRDGGEGCSWMFQPMNNSKMRVKRNLQPNSNAIPEGMREPSTDNPEEPGEAWSYFGRPWRNIRMPCSVLTLAKTKS CASLSARYLIQKLFTKDVLVQSNVYGNLKHGLCALDPNKISALREFLQENYPICDLSENGRDWKSCVTSINSGIRS LRHDVRRAEARSQSLPAVTPPELEQESKPGDPDATDPST
GeneID:
139105
Remarks:
Gene Accession: NM_153346.2
Add. information Mouse polyclonal antibody raised against a full-length human CXorf20 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 139105

Accessory Products

Proteins and/or Positive Controls

Positive controls for BEND2 (2 products)

Catalog No. Species Pres. Purity   Source  

CXorf20 293T Cell Transient Overexpression Lysate(Denatured)

CXorf20 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CXorf20 Lysate

Western Blot: CXorf20 Lysate [NBL1-09637] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BEND2
  Novus Biologicals Inc.
  • LinkedIn