TA337840 BEND2 antibody

Rabbit Polyclonal Anti-BEND2 Antibody

See related secondary antibodies

Search for all "BEND2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human BEND2

Product Description for BEND2

Rabbit anti Human BEND2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BEND2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BEN domain-containing protein 2, CXorf20
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NDZ0
Immunogen:
The immunogen for anti-BEND2 antibody: synthetic peptide directed towards the middle region of human BEND2. Synthetic peptide located within the following region: DGGEGCSWMFQPMNNSKMREKRNLQPNSNAIPEGMREPSTDNPEEPGEAW.
GeneID:
139105
Application WB
Background The exact functions of BEND2 remain unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for BEND2 (2 products)

Catalog No. Species Pres. Purity   Source  

CXorf20 293T Cell Transient Overexpression Lysate(Denatured)

CXorf20 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CXorf20 Lysate

Western Blot: CXorf20 Lysate [NBL1-09637] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BEND2
  Novus Biologicals Inc.
  • LinkedIn