discontinued

H00000119-D01P Beta-adducin (ADD2) antibody

See related secondary antibodies

Search for all "Beta-adducin (ADD2)"

Quick Overview

Rabbit anti Human Beta-adducin (ADD2)

Product Description for Beta-adducin (ADD2)

Rabbit anti Human Beta-adducin (ADD2).
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Beta-adducin (ADD2)

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms ADDB, Adducin 2, Erythrocyte adducin subunit beta
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P35612
Immunogen:
ADD2 (AAH65525.1, 1 a.a. ~ 726 a.a) full-length human protein.
AA Sequence:
MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMK KGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQL SDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFCLHSAIYAARPDVRCIIHL HTPATAAVSAMKWGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVEEAFY KIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRLGEHEFEALMRMLDNLGYRTG YTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGAPVPALRQHAQKQQKEKTRWLNTPNAYLRVNVADEVQRSMGSP RPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYTDPQEVLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPS TESQLMSKGDEDTKDDSEETVPNPFSQLTDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKE AETKSPLVSPSKSLEEGTKKTETSKAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKT ESVTSGPMSPEGSPSKSPSKKKKKFRTPSFLKKSKKKEKVES
GeneID:
119
Remarks:
Gene Accession: BC065525.1
Add. information Rabbit polyclonal antibody raised against a full-length human ADD2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 119

Accessory Products

Proteins and/or Positive Controls

Proteins for Beta-adducin (ADD2) (5 products)

Catalog No. Species Pres. Purity   Source  

Beta-adducin (ADD2) (transcript variant beta-4)

Beta-adducin (ADD2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Beta-adducin (ADD2) (transcript variant beta-1)

Beta-adducin (ADD2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Beta-adducin (ADD2) (transcript variant beta-2)

Beta-adducin (ADD2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Beta-adducin (ADD2)

Beta-adducin (ADD2) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Beta-adducin (ADD2)

Beta-adducin (ADD2) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Beta-adducin (ADD2) (6 products)

Catalog No. Species Pres. Purity   Source  

ADD2 overexpression lysate

ADD2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ADD2 overexpression lysate

ADD2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ADD2 overexpression lysate

ADD2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Beta-adducin (ADD2) Lysate(Denatured)

Beta-adducin (ADD2) Lysate(Denatured)
  Abnova Taiwan Corp.

beta Adducin Lysate

Western Blot: beta Adducin Lysate [NBL1-07331] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ADD2 Protein
  Novus Biologicals Inc.

beta Adducin Lysate

Western Blot: beta Adducin Lysate [NBL1-07332] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ADD2 Protein
  Novus Biologicals Inc.
  • LinkedIn