TA333644 BHLHB3 / BHLHE41 antibody

Rabbit Polyclonal Anti-BHLHB3 Antibody

See related secondary antibodies

Search for all "BHLHB3 / BHLHE41"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Porcine BHLHB3 / BHLHE41

Product Description for BHLHB3 / BHLHE41

Rabbit anti Bovine, Canine, Human, Porcine BHLHB3 / BHLHE41.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BHLHB3 / BHLHE41

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Class B basic helix-loop-helix protein 3, Class E basic helix-loop-helix protein 41, DEC2, Differentially expressed in chondrocytes protein 2, Enhancer-of-split and hairy-related protein 1, SHARP-1, SHARP1
Presentation Purified
Reactivity Bov, Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9C0J9
Immunogen:
The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI.
GeneID:
79365
Application WB
Background BHLHB3 may be a transcriptiol repressor that represses both basal and activated transcription. It play a role as a tumor suppressor for lung cancer. DEC1 and DEC2(BHLHB3) may play a crucial role in the adaptation to hypoxia and are regulators of the mammalian molecular clock, and form a fifth clock-gene family.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BHLHB3 / BHLHE41 (2 products)

Catalog No. Species Pres. Purity   Source  

BHLHB3 / BHLHE41

BHLHB3 / BHLHE41 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BHLHB3 / BHLHE41

BHLHB3 / BHLHE41 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn