TA342776 Blue-sensitive opsin antibody

Rabbit Polyclonal Anti-OPN1SW Antibody

See related secondary antibodies

Search for all "Blue-sensitive opsin"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Blue-sensitive opsin

Product Description for Blue-sensitive opsin

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Blue-sensitive opsin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Blue-sensitive opsin

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BCP, BOP, Blue cone photoreceptor pigment, OPN1SW
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-OPN1SW antibody: synthetic peptide directed towards the C terminal of human OPN1SW. Synthetic peptide located within the following region: SESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAERE.
Application WB
Background This gene belongs to the G-protein coupled receptor 1 family, opsin subfamily. It encodes the blue cone pigment gene which is one of three types of cone photoreceptors responsible for normal color vision. Defects in this gene are the cause of tritan color blindness (tritanopia). Affected individuals lack blue and yellow sensory mechanisms while retaining those for red and green. Defective blue vision is characteristic.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 534% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Blue-sensitive opsin (1 products)

Catalog No. Species Pres. Purity   Source  

Blue-sensitive opsin

Blue-sensitive opsin Human
  Abnova Taiwan Corp.
  • LinkedIn