
NBP1-52901 BMP2K antibody

See related secondary antibodies

Search for all "BMP2K"

0.1 mg / €360.00

Quick Overview

Rabbit anti Canine, Human BMP2K

Product Description for BMP2K

Rabbit anti Canine, Human BMP2K.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for BMP2K

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms BIKE, DKFZp434K0614, DKFZp434P0116, HRIHFB2017
Presentation Purified
Reactivity Can, Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the C terminal of BMP2K. Peptide sequence AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV.
Background BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation.This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 55589

Accessory Products

  • LinkedIn