
NBP1-52902 BMP2K antibody

See related secondary antibodies

Search for all "BMP2K"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse BMP2K

Product Description for BMP2K

Rabbit anti Human, Mouse BMP2K.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for BMP2K

Product Category Primary Antibodies
Quantity 50 µg
Synonyms BIKE, DKFZp434K0614, DKFZp434P0116, HRIHFB2017
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the middle region of BMP2K. Peptide sequence VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD.
Background BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 55589

Accessory Products

  • LinkedIn