discontinued

H00002662-A01 BMP3B / GDF10 antibody

See related secondary antibodies

Search for all "BMP3B / GDF10"

Quick Overview

Mouse anti Human, Mouse BMP3B / GDF10

Product Description for BMP3B / GDF10

Mouse anti Human, Mouse BMP3B / GDF10.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for BMP3B / GDF10

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BIP, Bone morphogenetic protein 3b, Bone-inducing protein, GDF-10, Growth/differentiation factor 10
Presentation Serum
Reactivity Hu, Ms
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P55107
Immunogen:
GDF10 (AAH28237, 1 a.a. ~ 289 a.a) full- length recombinant protein with GST tag.
AA Sequence:
MALAPPPRGLWQAKDISPIVKAARRDGELLLSAQLDSEERDPGVPRPSPYAPYILVYANDLAISEPNSVAVTLQRY DPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRK KGQEVFMAASQVLDFDEKTMQKARRKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVR PSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR*
GeneID:
2662
Remarks:
Gene Accession: BC028237
Add. information Mouse polyclonal antibody raised against a full-length recombinant GDF10.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human,Mouse
Gene ID 2662

Accessory Products

Proteins and/or Positive Controls

Proteins for BMP3B / GDF10 (10 products)

Catalog No. Species Pres. Purity   Source  

BMP3B / GDF10 (369-478)

BMP3B / GDF10 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €1,000.00
  Acris Antibodies GmbH

BMP3B / GDF10 (369-478)

BMP3B / GDF10 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €370.00
  Acris Antibodies GmbH

BMP3B / GDF10

BMP3B / GDF10 Human
  Abnova Taiwan Corp.

BMP3B / GDF10

BMP3B / GDF10 Human in vitro transl.
  Abnova Taiwan Corp.

BMP3B / GDF10

BMP3B / GDF10 Human in vitro transl.
  Abnova Taiwan Corp.

BMP3B / GDF10

BMP3B / GDF10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BMP3B / GDF10

BMP3B / GDF10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BMP3B / GDF10

BMP3B / GDF10 Human
  Abnova Taiwan Corp.

BMP3B / GDF10

BMP3B / GDF10 Human Purified > 95 % E. coli
  Alpha Diagnostic Intl. Inc.

BMP3B / GDF10

SDS-Page: GDF10 Protein [NBC1-28772] - GDF-10, 12.5 kDa (111aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for BMP3B / GDF10 (1 products)

Catalog No. Species Pres. Purity   Source  

GDF10 293T Cell Transient Overexpression Lysate(Denatured)

GDF10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn