discontinued

H00000656-M01 BMP8B antibody

See related secondary antibodies

Search for all "BMP8B"

Quick Overview

Mouse anti Human BMP8B 6D6

Product Description for BMP8B

Mouse anti Human BMP8B 6D6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for BMP8B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BMP-8B, Bone morphogenetic protein 8B, OP2, Osteogenic protein 2
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 6D6
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P34820
Immunogen:
BMP8B (NP_001711, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAI LQSLVHLMMPDAV*
GeneID:
656
Remarks:
Gene Accession: NM_001720
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant BMP8B.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 656

Accessory Products

Proteins and/or Positive Controls

Proteins for BMP8B (4 products)

Catalog No. Species Pres. Purity   Source  

BMP8B (264-402, His-tag)

BMP8B Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

BMP8B (264-402, His-tag)

BMP8B Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

BMP8B

BMP8B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BMP8B

BMP8B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BMP8B (1 products)

Catalog No. Species Pres. Purity   Source  

BMP8B overexpression lysate

BMP8B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn