discontinued

TA334107 BNC1 antibody

Rabbit Polyclonal Anti-Bnc1 Antibody

See related secondary antibodies

Search for all "BNC1"

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BNC1

TA334107

Product Description for BNC1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BNC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BNC1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein basonuclin-1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O35914
Immunogen:
The immunogen for Anti-Bnc1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI.
GeneID:
12173
Application WB
Background The function of Bnc1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn