discontinued

H00051236-B01P Brain protein 16 antibody

See related secondary antibodies

Search for all "Brain protein 16"

Quick Overview

Mouse anti Human Brain protein 16

H00051236-B01P

More Views

  • H00051236-B01P

Product Description for Brain protein 16

Mouse anti Human Brain protein 16.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Brain protein 16

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BRP16, C8orf30A, chromosome 8 open reading frame 30A
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTY7
Immunogen:
C8orf30A (NP_057542.2, 1 a.a. ~ 390 a.a) full-length human protein.
AA Sequence:
MGEAGAGAGASGGPEASPEAEVVKLLPFLAPGARADLQAAAVRHVLALTGCGPGRALLAGQAALLQALMELAPASA PARDAARALVNLAADPGLHETLLAADPGLPARLMGRALDPQWPWAEEAAAALANLSREPAPCAALMAALAAAEPAD SGLERLVRALCTPGYNARAPLHYLAPLLSNLSQRPAARAFLLDPDRCVVQRLLPLTQYPDSSVRRGGVVGTLRNCC FEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYLPPDKQREPDADIRKMLVEAIMLLTATAPGRQ QVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLERELAP EPWVERATPT
GeneID:
51236
Remarks:
Gene Accession: NM_016458
Add. information Mouse polyclonal antibody raised against a full-length human C8orf30A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 51236

Accessory Products

Proteins and/or Positive Controls

Proteins for Brain protein 16 (2 products)

Catalog No. Species Pres. Purity   Source  

Brain protein 16

Brain protein 16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Brain protein 16

Brain protein 16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Brain protein 16 (1 products)

Catalog No. Species Pres. Purity   Source  

C8orf30A 293T Cell Transient Overexpression Lysate(Denatured)

C8orf30A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn