TA335557 Brain protein 16 antibody

Rabbit Polyclonal Anti-FAM203A Antibody

See related secondary antibodies

Search for all "Brain protein 16"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Brain protein 16

Product Description for Brain protein 16

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Brain protein 16.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Brain protein 16

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BRP16, C8orf30A, chromosome 8 open reading frame 30A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-FAM203A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM203A. Synthetic peptide located within the following region: ADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACE.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Brain protein 16 (2 products)

Catalog No. Species Pres. Purity   Source  

Brain protein 16

Brain protein 16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Brain protein 16

Brain protein 16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Brain protein 16 (1 products)

Catalog No. Species Pres. Purity   Source  

C8orf30A 293T Cell Transient Overexpression Lysate(Denatured)

C8orf30A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn