TA337992 BRD9 antibody

Rabbit Polyclonal Anti-BRD9 Antibody

See related secondary antibodies

Search for all "BRD9"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish BRD9

Product Description for BRD9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish BRD9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BRD9

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Bromodomain-containing protein 9, MU-RMS-40.8, Rhabdomyosarcoma antigen MU-RMS-40.8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-BRD9 antibody: synthetic peptide directed towards the N terminal of human BRD9. Synthetic peptide located within the following region: AIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNR.
Application WB
Background BRD9 encodes a bromodomain containing 9 protein and is located on chromosome 5.
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for BRD9 (3 products)

Catalog No. Species Pres. Purity   Source  

BRD9 (full length, N-term HIS tag)

BRD9 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.


BRD9 Human Purified
  Abnova Taiwan Corp.


BRD9 Human Purified
  Abnova Taiwan Corp.

Positive controls for BRD9 (4 products)

Catalog No. Species Pres. Purity   Source  

BRD9 Lysate

BRD9 Lysate Protein
  Novus Biologicals Inc.

BRD9 overexpression lysate

BRD9 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

BRD9 overexpression lysate

BRD9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BRD9 overexpression lysate

BRD9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn