discontinued

H00056254-B01P BRE1A / RNF20 antibody

See related secondary antibodies

Search for all "BRE1A / RNF20"

Quick Overview

Mouse anti Human BRE1A / RNF20

H00056254-B01P

More Views

  • H00056254-B01P
  • H00056254-B01P
  • H00056254-B01P

Product Description for BRE1A / RNF20

Mouse anti Human BRE1A / RNF20.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for BRE1A / RNF20

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BRE1-A, E3 ubiquitin-protein ligase BRE1A, RING finger protein 20, hBRE1
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VTR2
Immunogen:
RNF20 (NP_062538.5, 1 a.a. ~ 975 a.a) full-length human protein.
AA Sequence:
MSGIGNKRAAGEPGTSMPPEKKAAVEDSGTTVETIKLGGVSSTEELDIRTLQTKNRKLAEMLDQRQAIEDELREHI EKLERRQATDDASLLIVNRYWSQFDENIRIILKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQ EPAFSFLATLASSSSEEMESQLQERVESSRRAVSQIVTVYDKLQEKVELLSRKLNSGDNLIVEEAVQELNSFLAQE NMRLQELTDLLQEKHRTMSQEFSKLQSKVETAESRVSVLESMIDDLQWDIDKIRKREQRLNRHLAEVLERVNSKGY KVYGAGSSLYGGTITINARKFEEMNAELEENKELAQNRLCELEKLRQDFEEVTTQNEKLKVELRSAVEQVVKETPE YRCMQSQFSVLYNESLQLKAHLDEARTLLHGTRGTHQHQVELIERDEVSLHKKLRTEVIQLEDTLAQVRKEYEMLR IEFEQTLAANEQAGPINREMRHLISSLQNHNHQLKGEVLRYKRKLREAQSDLNKTRLRSGSALLQSQSSTEDPKDE PAELKPDSEDLSSQSSASKASQEDANEIKSKRDEEERERERREKEREREREREKEKEREREKQKLKESEKERDSAK DKEKGKHDDGRKKEAEIIKQLKIELKKAQESQKEMKLLLDMYRSAPKEQRDKVQLMAAEKKSKAELEDLRQRLKDL EDKEKKENKKMADEDALRKIRAVEEQIEYLQKKLAMAKQEEEALLSEMDVTGQAFEDMQEQNIRLMQQLREKDDAN FKLMSERIKSNQIHKLLKEEKEELADQVLTLKTQVDAQLQVVRKLEEKEHLLQSNIGTGEKELGLRTQALEMNKRK AMEAAQLADDLKAQLELAQKKLHDFQDEIVENSVTKEKDMFNFKRAQEDISRLRRKLETTKKPDNVPKCDEILMEE IKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG
GeneID:
56254
Remarks:
Gene Accession: NM_019592.5
Add. information Mouse polyclonal antibody raised against a full-length human RNF20 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 56254

Accessory Products

Proteins and/or Positive Controls

Proteins for BRE1A / RNF20 (2 products)

Catalog No. Species Pres. Purity   Source  

BRE1A / RNF20

BRE1A / RNF20 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BRE1A / RNF20

BRE1A / RNF20 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BRE1A / RNF20 (2 products)

Catalog No. Species Pres. Purity   Source  

RNF20 293T Cell Transient Overexpression Lysate(Denatured)

RNF20 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RNF20 overexpression lysate

RNF20 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn