TA339895 BRICK1 / C3orf10 antibody

Rabbit Polyclonal Anti-BRK1 Antibody

See related secondary antibodies

Search for all "BRICK1 / C3orf10"

0.1 mg / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish BRICK1 / C3orf10


More Views

  • TA339895

Product Description for BRICK1 / C3orf10

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish BRICK1 / C3orf10.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for BRICK1 / C3orf10

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-C3orf10 antibody: synthetic peptide directed towards the middle region of human C3orf10. Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK.
Application WB
Background C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for BRICK1 / C3orf10 (5 products)

Catalog No. Species Pres. Purity   Source  

BRICK1 / C3orf10

BRICK1 / C3orf10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

BRICK1 / C3orf10 (1-75, His-tag)

BRICK1 / C3orf10 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

BRICK1 / C3orf10 (1-75, His-tag)

BRICK1 / C3orf10 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

BRICK1 / C3orf10

BRICK1 / C3orf10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BRICK1 / C3orf10

BRICK1 / C3orf10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BRICK1 / C3orf10 (1 products)

Catalog No. Species Pres. Purity   Source  

C3orf10 Lysate

Western Blot: C3orf10 Lysate [NBL1-08433] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C3orf10 Protein
  Novus Biologicals Inc.
  • LinkedIn