discontinued

H00000684-B02 BST2 antibody

See related secondary antibodies

Search for all "BST2"

50 µl / €370.00

Quick Overview

Mouse anti Human BST2

H00000684-B02

More Views

  • H00000684-B02
  • H00000684-B02
  • H00000684-B02
  • H00000684-B02

Product Description for BST2

Mouse anti Human BST2.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for BST2

Product Category Primary Antibodies
Quantity 50 µl
Synonyms -, MaxPab, bone marrow stromal cell antigen 2
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, P, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
BST2 (NP_004326.1, 1 a.a. ~ 180 a.a) full-length human protein.
AA Sequence:
MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTE AQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKK YYPSSQDSSSAAAPQLLIVLLGLSALLQ
Remarks:
Gene Accession: NM_004335
Add. information Mouse polyclonal antibody raised against a full-length human BST2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,IHC-P,WB-Ce,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn