discontinued

H00053339-B01P BTBD1 antibody

See related secondary antibodies

Search for all "BTBD1"

Quick Overview

Mouse anti Human BTBD1

Product Description for BTBD1

Mouse anti Human BTBD1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for BTBD1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BTB/POZ domain-containing protein 1, C15orf1, HCV NS5A-transactivated protein 8, Hepatitis C virus NS5A-transactivated protein 8, NS5ATP8
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0C5
Immunogen:
BTBD1 (NP_079514.1, 1 a.a. ~ 482 a.a) full-length human protein.
AA Sequence:
MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLG KGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIELPDVEPAAFLALLRFLYSDEVQIGPETVMTTL YTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDAISAEGFTDIDIDTLCAVL ERDTLSIRESRLFGAVVRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLMTIEEFAAGPAQSGILSDREVVNLF LHFTVNPKPRVEYIDRPRCCLRGKECCINRFQQVESRWGYSGTSDRIRFTVNRRISIVGFGLYGSIHGPTDYQVNI QIIEYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVF FFFSSPGNNNGTSIEDGQIPEIIFYT
GeneID:
53339
Remarks:
Gene Accession: NM_025238.3
Add. information Mouse polyclonal antibody raised against a full-length human BTBD1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 53339

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD1 (4 products)

Catalog No. Species Pres. Purity   Source  

BTBD1

BTBD1 Human Purified
  Abnova Taiwan Corp.

BTBD1

BTBD1 Human Purified
  Abnova Taiwan Corp.

BTBD1

BTBD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BTBD1

BTBD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BTBD1 (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD1 293T Cell Transient Overexpression Lysate(Denatured)

BTBD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BTBD1 overexpression lysate

BTBD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn